PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6KG156900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YB
Protein Properties Length: 153aa    MW: 16606.5 Da    PI: 8.8386
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6KG156900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB106.81.4e-3335123593
                NF-YB   5 drflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                             lP+an+ r+m++v+P+  +is  +k+++++c +ef  f+t+eas+++++++r+ti ++d++ ++  lGf++yve++++y+++yr  
  Pavir.6KG156900.1.p  35 GTALPMANIERLMRQVIPKGFRISSSSKQLTHDCTVEFACFITGEASEQARAQHRRTIRPEDYISSFEALGFDNYVETMSTYIRRYRGQ 123
                          578************************************************************************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.2E-2634127IPR009072Histone-fold
SuperFamilySSF471138.06E-2336128IPR009072Histone-fold
PfamPF008088.6E-153796IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.0E-66583No hitNo description
PRINTSPR006152.0E-684102No hitNo description
PRINTSPR006152.0E-6103121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MGRKGKRAAA TKGIRHEDAP PADCASSDGK ERAAGTALPM ANIERLMRQV IPKGFRISSS  60
SKQLTHDCTV EFACFITGEA SEQARAQHRR TIRPEDYISS FEALGFDNYV ETMSTYIRRY  120
RGQQDTAGNG NYALAHATVP PTVAAPDASR ND*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B3e-2038121891Transcription factor HapC (Eurofung)
4g91_B3e-2038121891Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701062.13e-45PREDICTED: nuclear transcription factor Y subunit B-1-like
TrEMBLK3YVP34e-45K3YVP3_SETIT; Uncharacterized protein
STRINGSi018339m1e-44(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP136592631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.71e-23nuclear factor Y, subunit B1